DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5281 and SLC35A2

DIOPT Version :10

Sequence 1:NP_650076.1 Gene:CG5281 / 41375 FlyBaseID:FBgn0037902 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001269580.1 Gene:SLC35A2 / 7355 HGNCID:11022 Length:421 Species:Homo sapiens


Alignment Length:199 Identity:37/199 - (18%)
Similarity:61/199 - (30%) Gaps:86/199 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 LEDGRNC---------EKFVLRSAFNTDQYPYLPDEIL--------------------WRQKEQF 454
            ||||...         :.|::   ||.|...:|..:.:                    |.::|..
Human     7 LEDGSTTGFLQYAYDGQDFII---FNKDTLSWLAMDYVAHITKQAWEANLHELQYQKNWLEEECI 68

  Fly   455 SDGVGYSWIDTLMKY----------CAAKITDKEFSQASKLFPHNTPHSKEAFYMRKIFHEQFPS 509
                  :|:...::|          ...:.|.||      .||..|     .|:.|.  |..:|.
Human    69 ------AWLKRFLEYGRDTLERTEHPVVRTTRKE------TFPGIT-----TFFCRA--HGFYPP 114

  Fly   510 EQAALTVRKWIPKWQKNQD------------PSGRASLVHENSAHNIGDEFCNNKSAISQHHIEQ 562
            | .::|       |.||.:            |||..:.....|. |:..:    .:.:...|:|.
Human   115 E-ISMT-------WMKNGEEIAQEVDYGGVLPSGDGTYQTWLSV-NLDPQ----SNDVYSCHVEH 166

  Fly   563 CRPQ 566
            |..|
Human   167 CGRQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5281NP_650076.1 RhaT 36..326 CDD:440461
SLC35A2NP_001269580.1 Nuc_sug_transp 59..367 CDD:398009 28/144 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.