DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5276 and cant1b

DIOPT Version :9

Sequence 1:NP_001287287.1 Gene:CG5276 / 41373 FlyBaseID:FBgn0037900 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_009304599.1 Gene:cant1b / 445201 ZFINID:ZDB-GENE-040801-114 Length:429 Species:Danio rerio


Alignment Length:387 Identity:189/387 - (48%)
Similarity:244/387 - (63%) Gaps:19/387 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RFNYHFALLIVCAF--VLVLLFYFARQGSHSSSDGYWLRRSYTDARSLDNGGPVVQA------YN 97
            ||.:.:..:.|.|.  :.||||.......|.|.......||:..:|  |..|.:|.|      ||
Zfish    54 RFRFRWRAIGVAALLALAVLLFQHHTSTDHGSDAPENSPRSWRSSR--DVSGAMVDAEPIGTQYN 116

  Fly    98 ATYPLTSPMVLRGGVINYRIAMIADLDTSSKVSKGDGSSTWRSYLKKGYLTYTVARSEIQISWDD 162
            .||||:.|.....| |.||||:||||||:|: ||.|  :||.||||:|::..:.:...:.:.||.
Zfish   117 DTYPLSPPEHTANG-IRYRIAVIADLDTNSR-SKKD--NTWFSYLKRGHVLVSESGDSVSVEWDP 177

  Fly   163 GAPIVLESAFALKGRGMELSELVTFNGRLLTFDDRTGLIYEIVNDKPIPWVILLDGDGHSAKGFK 227
            .. :.|||..:.|||||||||||.|||.|.:.|||||::|.|..::.:|||||.||||..:||||
Zfish   178 NT-VALESHLSEKGRGMELSELVAFNGHLYSVDDRTGVVYRIEGNRAVPWVILTDGDGSVSKGFK 241

  Fly   228 AEWATVKEQTLYVGSMGKEWTTSAGDFENNNPMYVKAITPSGEVRSLNWVDNFKQLRLQSMQITW 292
            |||..||::.||||.:||||||..|:|.||||.:||.:...|:|...|||..:..|: ::..|..
Zfish   242 AEWMAVKDERLYVGGLGKEWTTITGEFVNNNPEWVKVVGFHGDVEHENWVPRYSALK-RAADIKP 305

  Fly   293 PGYMIHESGTWSEERNRWFFLPRRCSKEKYNETKDEHMGCNVLVSADESFTNVETVRLDPENTTP 357
            |||:||||..|||...||||||||.|.|:|:||.||..|.|:::.....|:.:...|:.|  ..|
Zfish   306 PGYLIHESAVWSERLQRWFFLPRRASSERYDETADERRGTNLILRCSSDFSRISASRVGP--LKP 368

  Fly   358 THGFSSFKFLPGTDDSIIVALKSEELNGKTATFITAFDIAGKTLLPETRIETDYKYEGFEFI 419
            |.|||||||:|.|||.||:||||||..|..||:||||.:.|:.|||:|:| .|.||||.|||
Zfish   369 TLGFSSFKFIPDTDDQIILALKSEEDAGNIATYITAFTLDGRILLPDTKI-ADVKYEGLEFI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5276NP_001287287.1 Apyrase 123..418 CDD:283687 153/294 (52%)
cant1bXP_009304599.1 Apyrase 141..428 CDD:283687 153/294 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126948at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.