DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24-like and RLP24

DIOPT Version :9

Sequence 1:NP_650073.1 Gene:RpL24-like / 41372 FlyBaseID:FBgn0037899 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_013109.1 Gene:RLP24 / 850695 SGDID:S000003999 Length:199 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:88/182 - (48%)
Similarity:120/182 - (65%) Gaps:3/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVGWTKAYRKAAGKELAI 65
            |||..|:||||..|||||:.|||||.|.|:|||.|||||||:::||||:.||||:|||||||||:
Yeast     1 MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAGKELAV 65

  Fly    66 DPSFEFEKRRNVPMKYSRETWQKGLEAIKRVTEIKEKRTSHFVMERLRKGRQVEIQMDVKDVQRN 130
            |.:..|.:|||||::|:||.....|:|:.|:.||::||...|...|:|..::.:...|.|.|:.|
Yeast    66 DSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDFLRDKKLVESN 130

  Fly   131 MSL--IRSPAAGLKQRRAQEAAEEAALMEEDLPEEKITYVDA-RELEKKLEE 179
            ..|  ||......|..:.||.||..:..||...||:...:|: .|.|::||:
Yeast   131 PELLRIREVEIARKLAKEQERAESVSEQEESEEEEEDMEIDSDEEEEEQLEK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24-likeNP_650073.1 Ribosomal_L24e 2..64 CDD:279571 44/61 (72%)
RLP24NP_013109.1 Ribosomal_L24e 2..64 CDD:395998 44/61 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346249
Domainoid 1 1.000 110 1.000 Domainoid score I1395
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9462
Inparanoid 1 1.050 173 1.000 Inparanoid score I997
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004335
OrthoInspector 1 1.000 - - oto99222
orthoMCL 1 0.900 - - OOG6_101340
Panther 1 1.100 - - LDO PTHR10792
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1149
SonicParanoid 1 1.000 - - X3656
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.