DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24-like and STV1

DIOPT Version :9

Sequence 1:NP_650073.1 Gene:RpL24-like / 41372 FlyBaseID:FBgn0037899 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_190870.1 Gene:STV1 / 824468 AraportID:AT3G53020 Length:163 Species:Arabidopsis thaliana


Alignment Length:161 Identity:49/161 - (30%)
Similarity:75/161 - (46%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVGWTKAYRKAAGKELAI 65
            ::.:.|.|...|||||.|::|:|:|.:||.|...||.:.|..|..|.|:.||..|||...|:.|.
plant     3 LKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLAWTAMYRKQHKKDAAQ 67

  Fly    66 DPSFEFEKRRNVPMK-YSRETWQKGLEAIKR----------------VTEIKE--KRTSHFVMER 111
            :   ..::||....| |||......||.|::                :.||||  |:|     :.
plant    68 E---AVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALREIKERIKKT-----KD 124

  Fly   112 LRKGRQVEIQMDVKDVQRNMSLIRSPAAGLK 142
            .:|.::||.....:.|:.|.....:.:.|.|
plant   125 EKKAKKVEFASKQQKVKANFPKAAAASKGPK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24-likeNP_650073.1 Ribosomal_L24e 2..64 CDD:279571 26/61 (43%)
STV1NP_190870.1 Ribosomal_L24e 4..64 CDD:395998 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.