DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24-like and RSL24D1

DIOPT Version :9

Sequence 1:NP_650073.1 Gene:RpL24-like / 41372 FlyBaseID:FBgn0037899 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_057388.1 Gene:RSL24D1 / 51187 HGNCID:18479 Length:163 Species:Homo sapiens


Alignment Length:165 Identity:96/165 - (58%)
Similarity:128/165 - (77%) Gaps:6/165 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVGWTKAYRKAAGKELAI 65
            |||:.|||||..||||||:.|||||||||:||:.||||.||:|:|||||.||||:||||||||.:
Human     1 MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTV 65

  Fly    66 DPSFEFEKRRNVPMKYSRETWQKGLEAIKRVTEIKEKRTSHFVMERLRKGRQVEIQMDVKDVQRN 130
            |.|||||||||.|:||.||.|.|.::|:|||.|||:||.:.|:|.||:|.::::...|:|:|::|
Human    66 DNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQN 130

  Fly   131 MSLIRSPAAG----LKQRRAQEAAEEAALMEEDLP 161
            :.|||:|.||    |:::..|:..|:..:  ||.|
Human   131 IHLIRAPLAGKGKQLEEKMVQQLQEDVDM--EDAP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24-likeNP_650073.1 Ribosomal_L24e 2..64 CDD:279571 47/61 (77%)
RSL24D1NP_057388.1 Ribosomal_L24e 2..64 CDD:395998 47/61 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159151
Domainoid 1 1.000 118 1.000 Domainoid score I5873
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9462
Inparanoid 1 1.050 211 1.000 Inparanoid score I3663
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54151
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 1 1.000 - - FOG0004335
OrthoInspector 1 1.000 - - oto89015
orthoMCL 1 0.900 - - OOG6_101340
Panther 1 1.100 - - LDO PTHR10792
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1149
SonicParanoid 1 1.000 - - X3656
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.