DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24-like and rlp24

DIOPT Version :9

Sequence 1:NP_650073.1 Gene:RpL24-like / 41372 FlyBaseID:FBgn0037899 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_594839.1 Gene:rlp24 / 2541855 PomBaseID:SPAC22E12.13c Length:192 Species:Schizosaccharomyces pombe


Alignment Length:181 Identity:82/181 - (45%)
Similarity:108/181 - (59%) Gaps:5/181 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVGWTKAYRKAAGKELAI 65
            ||:.||||||..:|||||:.|||||.|||:|||.||||.||.|:|||||.||||||||.|||:..
pombe     1 MRVHTCYFCSGPVYPGHGIMFVRNDSKVFRFCRSKCHKNFKMKRNPRKVAWTKAYRKAHGKEMVY 65

  Fly    66 DPSFEF-EKRRNVPMKYSRETWQKGLEAIKRVTEIKEKRTSHFVMERLRKGRQVEIQMDVKDVQR 129
            |.:... ..|||||::|.|......|.|:|||:::..||...|..:||...|..|:|...|.:.:
pombe    66 DTALAVTAARRNVPVRYDRNVIATTLNAMKRVSQVHAKRERLFYKKRLAGKRAQELQEAQKLIAQ 130

  Fly   130 NMSLIRSPAAGLKQRRAQE---AAEEAALMEEDLPEE-KITYVDARELEKK 176
            |:.....|...::....||   .::|...|||::.|. ||..:..:...||
pombe   131 NVPQFTEPEGEVETAEVQEPQIVSDEEYTMEEEVAEPVKIPVLAKKRKNKK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24-likeNP_650073.1 Ribosomal_L24e 2..64 CDD:279571 46/61 (75%)
rlp24NP_594839.1 Ribosomal_L24e 2..64 CDD:279571 46/61 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 115 1.000 Domainoid score I1533
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I1274
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004335
OrthoInspector 1 1.000 - - oto100779
orthoMCL 1 0.900 - - OOG6_101340
Panther 1 1.100 - - LDO PTHR10792
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1149
SonicParanoid 1 1.000 - - X3656
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.