DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24-like and rpl24

DIOPT Version :9

Sequence 1:NP_650073.1 Gene:RpL24-like / 41372 FlyBaseID:FBgn0037899 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_775342.2 Gene:rpl24 / 192301 ZFINID:ZDB-GENE-020419-25 Length:157 Species:Danio rerio


Alignment Length:184 Identity:51/184 - (27%)
Similarity:82/184 - (44%) Gaps:37/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVGWTKAYRKAAGKELAI 65
            |:::.|.|...|||||||.::.|.|.|||:|...||..||..|:|||::.||..||:...|    
Zfish     1 MKVELCSFSGYKIYPGHGRRYARIDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKK---- 61

  Fly    66 DPSFEFEKRRNVPMKYSRETWQKGLEAIKRVTEIKEKRTSHFVMERLRKGRQVEIQMDVKDVQRN 130
            ..|.|..|:|.                 :|..:.:...|...:.|.|.|..|   :.:|:..||.
Zfish    62 GQSEEVSKKRT-----------------RRAVKFQRAITGASLAEILAKRNQ---KPEVRKAQRE 106

  Fly   131 MSLIRSPAAGLKQRRAQEAAEEAALMEEDLPEEKITYVDARELEK-KLEEGMGV 183
            .::    .|..:.::|::|.::........|        |:..:| |:.:.|.|
Zfish   107 QAI----RAAKEAKKAKQATKKQTTQSSKAP--------AKSAQKQKIAKPMKV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24-likeNP_650073.1 Ribosomal_L24e 2..64 CDD:279571 28/61 (46%)
rpl24NP_775342.2 Ribosomal_L24e 2..64 CDD:395998 28/65 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..157 13/69 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.