DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24-like and rpl-24.2

DIOPT Version :9

Sequence 1:NP_650073.1 Gene:RpL24-like / 41372 FlyBaseID:FBgn0037899 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_492572.1 Gene:rpl-24.2 / 172815 WormBaseID:WBGene00004437 Length:162 Species:Caenorhabditis elegans


Alignment Length:160 Identity:80/160 - (50%)
Similarity:110/160 - (68%) Gaps:3/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVGWTKAYRKAAGKELAI 65
            |||:.||||||.||||||:||||||..||||||.:|:|.||:||||||:.:|||.|:|.||||..
 Worm     1 MRIEKCYFCSSPIYPGHGIQFVRNDSTVFKFCRSRCNKLFKKKKNPRKLRFTKAARRARGKELIN 65

  Fly    66 DPSFEFEKRRNVPMKYSRETWQKGLEAIKRVTEIKEKRTSHFVMERLRKGRQVEIQMDVKDVQRN 130
            |.:...|:||:.|:||.|..:||.:||.|.::.:|.||..:.:.:||:.|:.|:.:..:..|.:.
 Worm    66 DATQLLEQRRDEPVKYERAMFQKTIEAAKTISALKTKRYGNLIRKRLQPGKIVQKKGLLAKVDKK 130

  Fly   131 MSLIRSPAA---GLKQRRAQEAAEEAALME 157
            |.|||:|.|   |:|.|.|.:..:.|..||
 Worm   131 MHLIRAPVANRDGVKTRAAAKEKKTAESME 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24-likeNP_650073.1 Ribosomal_L24e 2..64 CDD:279571 44/61 (72%)
rpl-24.2NP_492572.1 Ribosomal_L24e 2..64 CDD:279571 44/61 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166731
Domainoid 1 1.000 106 1.000 Domainoid score I4154
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9462
Inparanoid 1 1.050 158 1.000 Inparanoid score I2891
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54151
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 1 1.000 - - FOG0004335
OrthoInspector 1 1.000 - - oto18560
orthoMCL 1 0.900 - - OOG6_101340
Panther 1 1.100 - - LDO PTHR10792
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1149
SonicParanoid 1 1.000 - - X3656
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.