DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24-like and rsl24d1

DIOPT Version :9

Sequence 1:NP_650073.1 Gene:RpL24-like / 41372 FlyBaseID:FBgn0037899 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001120140.1 Gene:rsl24d1 / 100145176 XenbaseID:XB-GENE-979826 Length:163 Species:Xenopus tropicalis


Alignment Length:185 Identity:95/185 - (51%)
Similarity:134/185 - (72%) Gaps:24/185 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVGWTKAYRKAAGKELAI 65
            ||::.|||||:.||||||:.|||||||||:|||.||||.||:|:||||:.||||:||:|||||.:
 Frog     1 MRVEKCYFCSAPIYPGHGMMFVRNDCKVFRFCRSKCHKNFKKKRNPRKIRWTKAFRKSAGKELTV 65

  Fly    66 DPSFEFEKRRNVPMKYSRETWQKGLEAIKRVTEIKEKRTSHFVMERLRKGRQVEIQMDVKDVQRN 130
            |.:||||||||.|:||.||.|.|.:||:|||.|||:||.:.|:|.||:||::::...|:|:|::|
 Frog    66 DNAFEFEKRRNEPVKYKRELWSKTVEAMKRVEEIKQKRQARFIMNRLKKGKELQKAQDIKEVKQN 130

  Fly   131 MSLIRSPAAGLKQRRAQEAAEEAALMEEDLPEEKITYVDARELEKKLEEGMGVED 185
            :.|||:|.|| |.::.::                       ::.:||:|.:.:||
 Frog   131 IHLIRAPHAG-KTKQLED-----------------------KMVQKLQEDVDMED 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24-likeNP_650073.1 Ribosomal_L24e 2..64 CDD:279571 45/61 (74%)
rsl24d1NP_001120140.1 Ribosomal_L24e 2..66 CDD:366535 46/63 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5810
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9462
Inparanoid 1 1.050 210 1.000 Inparanoid score I3583
OMA 1 1.010 - - QHG54151
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 1 1.000 - - FOG0004335
OrthoInspector 1 1.000 - - oto102880
Panther 1 1.100 - - LDO PTHR10792
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1149
SonicParanoid 1 1.000 - - X3656
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.