DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtd and DTD1

DIOPT Version :9

Sequence 1:NP_650072.2 Gene:Dtd / 41371 FlyBaseID:FBgn0037898 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001304972.1 Gene:DTD1 / 92675 HGNCID:16219 Length:213 Species:Homo sapiens


Alignment Length:161 Identity:96/161 - (59%)
Similarity:117/161 - (72%) Gaps:8/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKILALRLFEEE-GKRWQK 64
            |:||:|||..|.|||..|.:|:||.|:|||:||...||.|::|::|||||.||:||:| ||.|.|
Human     1 MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSK 65

  Fly    65 SVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEEAQELYNQFLDRLGQSYDSTKIKDGKFGAY 129
            ||.|...|:||||||||...||||||||..||..|:|:..||.||::|.::|....|||||||||
Human    66 SVMDKQYEILCVSQFTLQCVLKGNKPDFHLAMPTEQAEGFYNSFLEQLRKTYRPELIKDGKFGAY 130

  Fly   130 MQVHIENDGPVTINLESP-------EQKDTD 153
            |||||:|||||||.||||       :.|.||
Human   131 MQVHIQNDGPVTIELESPAPGTATSDPKQTD 161

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DtdNP_650072.2 Tyr_Deacylase 2..145 CDD:308278 88/143 (62%)
DTD1NP_001304972.1 Dtyr_deacylase 1..147 CDD:238316 90/145 (62%)