DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtd and DTD1

DIOPT Version :9

Sequence 1:NP_650072.2 Gene:Dtd / 41371 FlyBaseID:FBgn0037898 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_010062.1 Gene:DTD1 / 851307 SGDID:S000002378 Length:150 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:68/150 - (45%)
Similarity:99/150 - (66%) Gaps:2/150 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKILALRLFEEEGKR-WQK 64
            |:.|:|:|..|.|.|..:::|||..|..:||||...|:..:::.|.:|:|:||:||:|.:. |:|
Yeast     1 MKIVLQKVSQASVVVDSKVISSIKHGYMLLVGISIDDSMAEIDKLSKKVLSLRIFEDESRNLWKK 65

  Fly    65 SVKDLNLELLCVSQFTLYHRL-KGNKPDFLAAMKGEEAQELYNQFLDRLGQSYDSTKIKDGKFGA 128
            ::|:.|.|:|.||||||..:. ||.||||..|.||..|:|||.:||..|.......|:|||:|||
Yeast    66 NIKEANGEILSVSQFTLMAKTKKGTKPDFHLAQKGHIAKELYEEFLKLLRSDLGEEKVKDGEFGA 130

  Fly   129 YMQVHIENDGPVTINLESPE 148
            .|...:.|:|||||.|:|.:
Yeast   131 MMSCSLTNEGPVTIILDSDQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtdNP_650072.2 Tyr_Deacylase 2..145 CDD:308278 65/144 (45%)
DTD1NP_010062.1 Dtyr_deacylase 1..148 CDD:412262 67/146 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344774
Domainoid 1 1.000 125 1.000 Domainoid score I1196
eggNOG 1 0.900 - - E1_COG1490
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5518
Inparanoid 1 1.050 129 1.000 Inparanoid score I1255
Isobase 1 0.950 - 0 Normalized mean entropy S712
OMA 1 1.010 - - QHG62473
OrthoFinder 1 1.000 - - FOG0003821
OrthoInspector 1 1.000 - - oto99368
orthoMCL 1 0.900 - - OOG6_101644
Panther 1 1.100 - - LDO PTHR10472
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R353
SonicParanoid 1 1.000 - - X2664
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.