DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtd and AT4G18460

DIOPT Version :9

Sequence 1:NP_650072.2 Gene:Dtd / 41371 FlyBaseID:FBgn0037898 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_193582.2 Gene:AT4G18460 / 827578 AraportID:AT4G18460 Length:153 Species:Arabidopsis thaliana


Alignment Length:150 Identity:78/150 - (52%)
Similarity:104/150 - (69%) Gaps:2/150 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKILALRLFEEE--GKRWQ 63
            ||||||||.::.|||...:||.|||||.||:||..|||..|.:|:.||:|.:|||..|  ||.|.
plant     1 MRAVIQRVSSSSVTVDGRIVSEIGPGLLVLIGIHESDTESDADYICRKVLNMRLFSNETTGKGWD 65

  Fly    64 KSVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEEAQELYNQFLDRLGQSYDSTKIKDGKFGA 128
            ::|...|..:|.|||||||..||||||||..||..::|:..|...:::..::|:...:|||.|||
plant    66 QNVMQRNYGVLLVSQFTLYGFLKGNKPDFHVAMPPDKAKPFYASLVEKFQKAYNPDAVKDGVFGA 130

  Fly   129 YMQVHIENDGPVTINLESPE 148
            .|||::.||||||:.|:||:
plant   131 MMQVNLVNDGPVTMQLDSPQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtdNP_650072.2 Tyr_Deacylase 2..145 CDD:308278 74/144 (51%)
AT4G18460NP_193582.2 PTZ00120 1..153 CDD:185458 78/149 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1453
eggNOG 1 0.900 - - E1_COG1490
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5518
Inparanoid 1 1.050 154 1.000 Inparanoid score I1685
OMA 1 1.010 - - QHG62473
OrthoDB 1 1.010 - - D1411453at2759
OrthoFinder 1 1.000 - - FOG0003821
OrthoInspector 1 1.000 - - oto3496
orthoMCL 1 0.900 - - OOG6_101644
Panther 1 1.100 - - LDO PTHR10472
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2664
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.