DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtd and dtd2

DIOPT Version :9

Sequence 1:NP_650072.2 Gene:Dtd / 41371 FlyBaseID:FBgn0037898 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001004011.1 Gene:dtd2 / 445510 ZFINID:ZDB-GENE-040822-45 Length:160 Species:Danio rerio


Alignment Length:157 Identity:37/157 - (23%)
Similarity:68/157 - (43%) Gaps:14/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RAVIQRVKAAKVTVL--DELVSS----IGPGLCVLVGIKASDTAKDVEYLVRKILALRLFEEEGK 60
            |.|:|:...|::.|.  ||...:    :..|:.:.:......|...:..:|..:|.::|.|.|..
Zfish     4 RVVLQQCLHARLQVKPPDEESEAEWVEVNRGMVIYICFFKGATEDLIPKMVNTLLNVKLCETESG 68

  Fly    61 RWQKSVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEEAQELYNQFLDRLGQSYDS------- 118
            :: .||..|...:|.|.|.||..:.||....:...:..:|..:||..|:........|       
Zfish    69 KF-TSVLQLPGSVLIVPQATLGGKPKGRGMQYHGNIGKDEGLKLYETFVSLCQSELSSCKNSDIL 132

  Fly   119 TKIKDGKFGAYMQVHIENDGPVTINLE 145
            |::|.|.:|....:.::.:||.|..:|
Zfish   133 TEVKHGTYGNRQVLKLDTNGPYTHLME 159

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DtdNP_650072.2 Tyr_Deacylase 2..145 CDD:308278 36/155 (23%)
dtd2NP_001004011.1 Tyr_Deacylase 4..159 CDD:280702 36/155 (23%)