DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtd and dtd1

DIOPT Version :9

Sequence 1:NP_650072.2 Gene:Dtd / 41371 FlyBaseID:FBgn0037898 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001003440.1 Gene:dtd1 / 445046 ZFINID:ZDB-GENE-040801-175 Length:207 Species:Danio rerio


Alignment Length:148 Identity:94/148 - (63%)
Similarity:113/148 - (76%) Gaps:1/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKILALRLFEEE-GKRWQK 64
            |:|:||||..|.|||.:|.:||||.|||||:||.|.||.|||:|:|||||.||:||:| |:.|.:
Zfish     1 MKAIIQRVTRASVTVGEEQISSIGRGLCVLLGISAEDTQKDVDYMVRKILNLRVFEDENGRAWSR 65

  Fly    65 SVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEEAQELYNQFLDRLGQSYDSTKIKDGKFGAY 129
            ||.|..||:||||||||...|||||||:.|||..|.||..||..|::|.::|....||||:|||.
Zfish    66 SVMDGELEVLCVSQFTLQCLLKGNKPDYHAAMPAELAQPFYNNMLEQLRETYKPELIKDGQFGAK 130

  Fly   130 MQVHIENDGPVTINLESP 147
            |||.|:|||||||.||||
Zfish   131 MQVLIQNDGPVTIQLESP 148

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DtdNP_650072.2 Tyr_Deacylase 2..145 CDD:308278 89/143 (62%)
dtd1NP_001003440.1 Tyr_Deacylase 2..146 CDD:280702 89/143 (62%)