DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtd and Dtd1

DIOPT Version :9

Sequence 1:NP_650072.2 Gene:Dtd / 41371 FlyBaseID:FBgn0037898 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_006235190.1 Gene:Dtd1 / 362227 RGDID:1311821 Length:209 Species:Rattus norvegicus


Alignment Length:148 Identity:92/148 - (62%)
Similarity:112/148 - (75%) Gaps:1/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKILALRLFEEE-GKRWQK 64
            |:||:|||..|.|||..|.:|:||.|:|||:||...||.|::|::|||||.||:||:| ||.|.|
  Rat     1 MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISMEDTQKELEHMVRKILNLRVFEDESGKHWSK 65

  Fly    65 SVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEEAQELYNQFLDRLGQSYDSTKIKDGKFGAY 129
            ||.|...|:||||||||...|||||||...||..|:|:..||.||::|.:||....|:|||||||
  Rat    66 SVMDKEYEVLCVSQFTLQCVLKGNKPDLHLAMPTEQAESFYNSFLEQLRKSYRPELIRDGKFGAY 130

  Fly   130 MQVHIENDGPVTINLESP 147
            |||||:|||||||.||||
  Rat   131 MQVHIQNDGPVTIELESP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtdNP_650072.2 Tyr_Deacylase 2..145 CDD:308278 87/143 (61%)
Dtd1XP_006235190.1 Dtyr_deacylase 1..147 CDD:238316 89/145 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345798
Domainoid 1 1.000 174 1.000 Domainoid score I3587
eggNOG 1 0.900 - - E1_COG1490
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5518
Inparanoid 1 1.050 180 1.000 Inparanoid score I3905
OMA 1 1.010 - - QHG62473
OrthoDB 1 1.010 - - D1411453at2759
OrthoFinder 1 1.000 - - FOG0003821
OrthoInspector 1 1.000 - - oto96492
orthoMCL 1 0.900 - - OOG6_101644
Panther 1 1.100 - - LDO PTHR10472
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2664
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.