DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtd and DTD2

DIOPT Version :9

Sequence 1:NP_650072.2 Gene:Dtd / 41371 FlyBaseID:FBgn0037898 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_542395.1 Gene:DTD2 / 112487 HGNCID:20277 Length:168 Species:Homo sapiens


Alignment Length:159 Identity:40/159 - (25%)
Similarity:73/159 - (45%) Gaps:17/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RAVIQRVKAAKVTV--LDELVSS----IGPGLCVLVGIKASDTAKDVEYLVRKILALRLFE-EEG 59
            ||::|:...|::.:  .|..|::    :..||.:.|........:.:..:|..:|.::|.| |.|
Human    11 RALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENG 75

  Fly    60 KRWQKSVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEEAQELYNQFLDRLGQSYDSTK---- 120
            |  ..|:.||...:|.:.|.||..||||....:.:....||..|||:||:....:...:..    
Human    76 K--HVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAE 138

  Fly   121 ----IKDGKFGAYMQVHIENDGPVTINLE 145
                ::.|.:|....:.::.:||.|..:|
Human   139 ARVVVEHGTYGNRQVLKLDTNGPFTHLIE 167

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DtdNP_650072.2 Tyr_Deacylase 2..145 CDD:308278 39/157 (25%)
DTD2NP_542395.1 Tyr_Deacylase 11..167 CDD:280702 39/157 (25%)