DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtd and dtd1

DIOPT Version :9

Sequence 1:NP_650072.2 Gene:Dtd / 41371 FlyBaseID:FBgn0037898 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001120286.1 Gene:dtd1 / 100145342 XenbaseID:XB-GENE-958228 Length:207 Species:Xenopus tropicalis


Alignment Length:148 Identity:93/148 - (62%)
Similarity:112/148 - (75%) Gaps:1/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKILALRLF-EEEGKRWQK 64
            ||||||||..|.|||.||.:||||.|:|||:||...||.||:||:|||||.||:| :|.||:|.|
 Frog     1 MRAVIQRVTRASVTVGDEQISSIGRGICVLLGISVEDTQKDIEYMVRKILNLRVFADESGKQWCK 65

  Fly    65 SVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEEAQELYNQFLDRLGQSYDSTKIKDGKFGAY 129
            ||.|...|:||||||||...|||||||:..||..|:|:..||.||.::.::|....|:|||||||
 Frog    66 SVMDKQYEVLCVSQFTLQCVLKGNKPDYHMAMPSEQAEPFYNVFLQQMRKAYKPELIQDGKFGAY 130

  Fly   130 MQVHIENDGPVTINLESP 147
            |||:|:|||||||.||.|
 Frog   131 MQVNIQNDGPVTIELEPP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtdNP_650072.2 Tyr_Deacylase 2..145 CDD:308278 89/143 (62%)
dtd1NP_001120286.1 Tyr_Deacylase 2..146 CDD:376833 89/143 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3541
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5518
Inparanoid 1 1.050 181 1.000 Inparanoid score I3875
OMA 1 1.010 - - QHG62473
OrthoDB 1 1.010 - - D1411453at2759
OrthoFinder 1 1.000 - - FOG0003821
OrthoInspector 1 1.000 - - oto103201
Panther 1 1.100 - - LDO PTHR10472
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R353
SonicParanoid 1 1.000 - - X2664
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.