DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5270 and PLEKHF2

DIOPT Version :9

Sequence 1:NP_731570.2 Gene:CG5270 / 41370 FlyBaseID:FBgn0037897 Length:2243 Species:Drosophila melanogaster
Sequence 2:NP_078889.1 Gene:PLEKHF2 / 79666 HGNCID:20757 Length:249 Species:Homo sapiens


Alignment Length:238 Identity:58/238 - (24%)
Similarity:90/238 - (37%) Gaps:55/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1328 CFDKTGHVYDVQSSAGLGSGA------GETPAKIRFQLGQTTSEAFILLNFNSYQQDHFVG---- 1382
            ||...|....:.....:|.|.      .:..|:..|..........|::....|.:.|.:.    
Human    21 CFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENV 85

  Fly  1383 -----QDCLDL----LLRIYASKALDYHVANVRAASEPSSLGTDVHNSLDSLCGAFVMPK--QAP 1436
                 :|..||    |::. .:|:...:.|   .|:|.|.....::.     |...::.|  :.|
Human    86 TIDSIKDEGDLRNGWLIKT-PTKSFAVYAA---TATEKSEWMNHINK-----CVTDLLSKSGKTP 141

  Fly  1437 NRQQ---WTRDEEASHCMCCRRAAFTMLMRRHHCRRCGRVVCYACSTHRIRIPELYDELEVRICN 1498
            :.:.   |..|.||:.||.|::|.||.:.||||||:||.|||..||..|..:|. .....||||:
Human   142 SNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPS-QSSKPVRICD 205

  Fly  1499 DC---------AAC------------STPAKDQGDGTSSERSA 1520
            .|         |.|            .:|..|..|....:.|:
Human   206 FCYDLLSAGDMATCQPARSDSYSQSLKSPLNDMSDDDDDDDSS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5270NP_731570.2 PHD_SF 1441..1500 CDD:304600 29/58 (50%)
PLEKHF2NP_078889.1 PH_Phafin2-like 7..129 CDD:269927 19/116 (16%)
FYVE_PKHF2 148..211 CDD:277294 30/63 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..249 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.