Sequence 1: | NP_731570.2 | Gene: | CG5270 / 41370 | FlyBaseID: | FBgn0037897 | Length: | 2243 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_078889.1 | Gene: | PLEKHF2 / 79666 | HGNCID: | 20757 | Length: | 249 | Species: | Homo sapiens |
Alignment Length: | 238 | Identity: | 58/238 - (24%) |
---|---|---|---|
Similarity: | 90/238 - (37%) | Gaps: | 55/238 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 1328 CFDKTGHVYDVQSSAGLGSGA------GETPAKIRFQLGQTTSEAFILLNFNSYQQDHFVG---- 1382
Fly 1383 -----QDCLDL----LLRIYASKALDYHVANVRAASEPSSLGTDVHNSLDSLCGAFVMPK--QAP 1436
Fly 1437 NRQQ---WTRDEEASHCMCCRRAAFTMLMRRHHCRRCGRVVCYACSTHRIRIPELYDELEVRICN 1498
Fly 1499 DC---------AAC------------STPAKDQGDGTSSERSA 1520 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5270 | NP_731570.2 | PHD_SF | 1441..1500 | CDD:304600 | 29/58 (50%) |
PLEKHF2 | NP_078889.1 | PH_Phafin2-like | 7..129 | CDD:269927 | 19/116 (16%) |
FYVE_PKHF2 | 148..211 | CDD:277294 | 30/63 (48%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 221..249 | 4/28 (14%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1237900at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |