DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5270 and plekhf1

DIOPT Version :9

Sequence 1:NP_731570.2 Gene:CG5270 / 41370 FlyBaseID:FBgn0037897 Length:2243 Species:Drosophila melanogaster
Sequence 2:NP_001016010.1 Gene:plekhf1 / 548764 XenbaseID:XB-GENE-996039 Length:269 Species:Xenopus tropicalis


Alignment Length:95 Identity:32/95 - (33%)
Similarity:50/95 - (52%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1436 PNRQQ---WTRDEEASHCMCCRRAAFTMLMRRHHCRRCGRVVCYACSTHRIRIPELYDELEVRIC 1497
            |:::.   |..|:....||.|.:..||::.||||||:||.|||:.||.::..||.:..: .||:|
 Frog   141 PSKEHAAPWIPDKATDICMRCTQTNFTLVNRRHHCRKCGFVVCHECSKYKFLIPTIKSK-PVRVC 204

  Fly  1498 NDCAACSTPAKDQGDGTSSERSAISGQVSK 1527
            :.|.          ....||:.||..:|.:
 Frog   205 SLCY----------KKLVSEKVAIEEEVKR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5270NP_731570.2 PHD_SF 1441..1500 CDD:304600 25/58 (43%)
plekhf1NP_001016010.1 PH_Phafin2-like 7..129 CDD:269927
PH 39..131 CDD:278594
PHD_SF 148..211 CDD:304600 26/73 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.