DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5270 and Plekhf1

DIOPT Version :9

Sequence 1:NP_731570.2 Gene:CG5270 / 41370 FlyBaseID:FBgn0037897 Length:2243 Species:Drosophila melanogaster
Sequence 2:NP_001013166.1 Gene:Plekhf1 / 308543 RGDID:1310544 Length:279 Species:Rattus norvegicus


Alignment Length:228 Identity:54/228 - (23%)
Similarity:85/228 - (37%) Gaps:23/228 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1328 CFDKTGHVYDVQSSAGLGSGA------GETPAKIRFQLGQTTSEAFILLNFNSYQQDHFVG---- 1382
            ||..:|....:.....||.|.      .:...:|.|..........|:|:...|:..|.:.    
  Rat    21 CFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLSKRKYRSQHIIPLEEV 85

  Fly  1383 -----QDCLDLLLRIYASKALDYHVANVRAASEPSSLGTDVHNSLDSLCGAFVMPKQAPNRQQWT 1442
                 .:.|....|.....|....|.:..:.:|.....:.:...:.....|........:...|.
  Rat    86 TLEPLPETLQAKNRWMIKTAKKSFVVSAASTTERQEWISHIEECVRRQLLATGRQPTTEHAAPWI 150

  Fly  1443 RDEEASHCMCCRRAAFTMLMRRHHCRRCGRVVCYACSTHRIRIPELYDELEVRICNDC----AAC 1503
            .|:....||.|.:..|:.|.||||||:||.|||..||..|..:|.|..: .:|:|:.|    ||.
  Rat   151 PDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRERFLLPRLSPK-PLRVCSLCYRELAAQ 214

  Fly  1504 S--TPAKDQGDGTSSERSAI-SGQVSKSSGRSD 1533
            .  ..||::..|:..:.:.: |.....|||..|
  Rat   215 KRREEAKERFRGSPGQLTHLGSTMCGASSGDDD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5270NP_731570.2 PHD_SF 1441..1500 CDD:304600 25/58 (43%)
Plekhf1NP_001013166.1 PH_Phafin2-like 7..129 CDD:269927 17/107 (16%)
PH 39..131 CDD:278594 12/91 (13%)
FYVE_PKHF1 148..211 CDD:277293 26/63 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..264 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.