DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaG and CHDH

DIOPT Version :10

Sequence 1:NP_650070.1 Gene:ninaG / 41369 FlyBaseID:FBgn0037896 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_060867.2 Gene:CHDH / 55349 HGNCID:24288 Length:594 Species:Homo sapiens


Alignment Length:34 Identity:9/34 - (26%)
Similarity:11/34 - (32%) Gaps:8/34 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GYNAPYGGHGGYAPP--------PVHGAPGYMPP 33
            |:..|.......|.|        ||..:|...||
Human   137 GWKEPLVQREDQAAPEPSCVPKEPVPPSPESRPP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaGNP_650070.1 BetA 66..593 CDD:441878
CHDHNP_060867.2 PRK02106 40..594 CDD:235000 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.