DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaG and CG45065

DIOPT Version :9

Sequence 1:NP_650070.1 Gene:ninaG / 41369 FlyBaseID:FBgn0037896 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001285251.1 Gene:CG45065 / 19835504 FlyBaseID:FBgn0266435 Length:613 Species:Drosophila melanogaster


Alignment Length:603 Identity:175/603 - (29%)
Similarity:280/603 - (46%) Gaps:109/603 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FDYVIVGGGTGGSTLTSLLAKNSNGSVLLIEAGGQFGLLSRIPLLTTFQQKGINDWSFLSVPQKH 111
            :|:|::|||:.|:.:.:.|::..|.:|||:||||....:|.:|.|..:.|....||.:.:.|.  
  Fly    44 YDFVVIGGGSAGAVVANRLSEVRNWTVLLLEAGGDETEISDVPALAGYLQLTELDWKYQTTPS-- 106

  Fly   112 SSRGLIERR---QCL-PRGKGLGGSANLNYMLHFDGHGPDFDSWRDHHNLSDWSW-AQMRSFMAA 171
            |:|...:..   :|. ||||.||||:.||.|::..|...|::.|....| ..|.: :.::.|:.:
  Fly   107 STRQYCQAMKGDRCFWPRGKVLGGSSVLNAMVYVRGSKNDYNHWASLGN-PGWDYDSMLKYFLKS 170

  Fly   172 AKPKNPDMLEIPRR-------------YSKLTEALEEAQAQFAYKD----------WIFRRSLYN 213
            ...:||.:.:.|..             .:.|:.|..:|..:..|::          ::..:|  .
  Fly   171 EDVRNPYLAKTPYHETGGYLTVQEAPWRTPLSIAFLQAGIEMGYENRDINGAQQTGFMLTQS--T 233

  Fly   214 IRNGLRHSVVQQFLNPVIHHSNLRLLPDALVKRIQLAPSPFLQATSIL-------VGIKDEENRE 271
            ||.|.|.|..:.|:.||....|..:|..|             :||.||       :|::......
  Fly   234 IRRGARCSTGKAFIRPVRQRKNFDVLLHA-------------EATRILFDKQKRAIGVEYMRGGR 285

  Fly   272 KEFSIEVRRELILCAGAYQTPQLLMASGIGDVSALKKLGIPAQHSLPLVGHNLHDHFNLP--LFV 334
            |.. :.||||:|..|||..||:|||.||:|....|::..||....|| ||:|:.||..|.  .||
  Fly   286 KNV-VFVRREVIASAGALNTPKLLMLSGVGPAEHLQEHNIPVISDLP-VGNNMQDHVGLGGLTFV 348

  Fly   335 SMGVTGP-TLNQNTLLNPMTLINYLSSGSGPLGNFGVLGNVVSYGGLGAPPYGITFFGAGAIDES 398
               |..| |:.:|........:.|:....||:...||              .|:.|......|.|
  Fly   349 ---VDAPLTVTRNRFQTIPVSMEYILRERGPMTFSGV--------------EGVAFLNTKYQDPS 396

  Fly   399 ----------ALMSISNFKGPAFRALF---PRYYNS------SQEGFVVISSCLQPKSRGSVGLL 444
                      ...||::..|...|.:.   ..:||:      ..|.:.::...|:|||.|.|.|.
  Fly   397 VDWPDVQFHFCPSSINSDGGEQIRKILNLRDGFYNTVYKPLQHSETWSILPLLLRPKSTGWVRLN 461

  Fly   445 NRHMRRNPLIDPNYLSSEEDVACTISAIRSAVELVNSTAFAALHPRIHWPRVQECSNFGPFERDF 509
            :|:.:..|.|.|||.:.:||:...:..|:.|:.:.|:.||.....|:|...:..|.:. ||:   
  Fly   462 SRNPQHQPKIIPNYFAHQEDIDVLVEGIKLAINVSNTQAFQRFGSRLHNIPLPGCRHL-PFQ--- 522

  Fly   510 FDNRPSDQYLECLMRHVGLGSHHPGGTCALG------SVVDSQLRLKGVSNVRVVDASVLPRPIS 568
                 |::|..|.::......:||.|||.:|      :|||.:||:.|||.|||||||::|..::
  Fly   523 -----SNEYWACCIKEFTFTIYHPAGTCRMGPSWDVTAVVDPRLRVYGVSGVRVVDASIMPTIVN 582

  Fly   569 GNPNSVVVAIALRAASWI 586
            ||||:.|:||..:|:..|
  Fly   583 GNPNAPVIAIGEKASDLI 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaGNP_650070.1 BetA 72..588 CDD:225186 167/578 (29%)
NADB_Rossmann 119..327 CDD:304358 67/242 (28%)
GMC_oxred_C 435..582 CDD:282984 56/152 (37%)
CG45065NP_001285251.1 PRK02106 42..601 CDD:235000 175/603 (29%)
NADB_Rossmann 117..339 CDD:304358 67/239 (28%)
GMC_oxred_C 452..596 CDD:282984 56/152 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446447
Domainoid 1 1.000 69 1.000 Domainoid score I3423
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000165
OrthoInspector 1 1.000 - - otm47571
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11552
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X135
76.940

Return to query results.
Submit another query.