DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blm and RECQL

DIOPT Version :10

Sequence 1:NP_524319.2 Gene:Blm / 41366 FlyBaseID:FBgn0002906 Length:1487 Species:Drosophila melanogaster
Sequence 2:NP_002898.2 Gene:RECQL / 5965 HGNCID:9948 Length:649 Species:Homo sapiens


Alignment Length:43 Identity:11/43 - (25%)
Similarity:19/43 - (44%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDSIKIRKAKRVLALSPRQYTLVSSNSSWSEHKRGLRRHLDRT 70
            |..:|....||..|::.:.:   ||||.......|.:.:.:.|
Human   195 TGGLKFNIQKRPFAVTSQSF---SSNSEGQHSSFGPQPNSENT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BlmNP_524319.2 RecQ 733..1217 CDD:440280
HRDC 1283..1357 CDD:470625
RECQLNP_002898.2 recQ_fam 81..543 CDD:129701 11/43 (26%)
DEVH box 219..222 0/2 (0%)
Winged-helix domain. /evidence=ECO:0000269|PubMed:19151156 481..592
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 595..649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.