powered by:
Protein Alignment Blm and SPAC212.06c
DIOPT Version :9
Sequence 1: | NP_524319.2 |
Gene: | Blm / 41366 |
FlyBaseID: | FBgn0002906 |
Length: | 1487 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001343026.1 |
Gene: | SPAC212.06c / 3361375 |
PomBaseID: | SPAC212.06c |
Length: | 147 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 52 |
Identity: | 25/52 - (48%) |
Similarity: | 28/52 - (53%) |
Gaps: | 0/52 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1027 VRFVLHYSLPKSIEGYYQEAGRAGRDGDVADCILYYNYSDMLRIKKMLDSDK 1078
||.|:||.||.|...|.||.|||||||..|...|:|...|......:.||.|
pombe 3 VRLVVHYRLPASSMDYVQETGRAGRDGKYAIAALFYEKYDSTWSSYVEDSMK 54
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0514 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.