DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mgr and PAC10

DIOPT Version :9

Sequence 1:NP_650067.1 Gene:mgr / 41365 FlyBaseID:FBgn0264694 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_011592.3 Gene:PAC10 / 852969 SGDID:S000003310 Length:199 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:68/180 - (37%)
Similarity:103/180 - (57%) Gaps:16/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QKTFAGIPEAVFLEEIDTFMSQPEN-ENCEKVLQRLDEQHGKYRFMACNLEARRRKLKSQIPDLE 80
            :|...|||:|.|:|.::..:..|.: |.|   ..:..|:..||:||..:..|..::||::|||||
Yeast     9 EKNARGIPQAPFIENVNEIIKDPSDFELC---FNKFQERLSKYKFMQESKLATIKQLKTRIPDLE 70

  Fly    81 RSLEMVNVLRKEDEERE-------TQFLLSDQVFIKTLV--PPTKT---VYLWLGASVMLEYPLD 133
            .:|::...||...:|.:       ..:.|:|.::.|..|  |..:.   |.|||||.||||||:|
Yeast    71 NTLKICQSLRNHSDEGDESDEPILLHYQLNDTLYTKAQVDIPEDRADLKVGLWLGADVMLEYPID 135

  Fly   134 EAEALLNQNITSAVGNLKSVEHDQDFLRDQITTTEVNMARVYNWGVKKRQ 183
            ||..||.:.:..:..:|.....|.:|||:.|||.|||.||:|||.|::||
Yeast   136 EAIELLKKKLADSEQSLTVSTEDVEFLRENITTMEVNCARLYNWDVQRRQ 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgrNP_650067.1 Prefoldin 58..175 CDD:281054 50/128 (39%)
PAC10NP_011592.3 Prefoldin 48..177 CDD:397237 50/128 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346696
Domainoid 1 1.000 89 1.000 Domainoid score I1805
eggNOG 1 0.900 - - E1_KOG3313
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2531
Inparanoid 1 1.050 113 1.000 Inparanoid score I1361
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53938
OrthoFinder 1 1.000 - - FOG0005083
OrthoInspector 1 1.000 - - oto98927
orthoMCL 1 0.900 - - OOG6_102595
Panther 1 1.100 - - LDO PTHR12409
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R906
SonicParanoid 1 1.000 - - X3603
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.