DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mgr and VBP1

DIOPT Version :9

Sequence 1:NP_650067.1 Gene:mgr / 41365 FlyBaseID:FBgn0264694 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001290472.1 Gene:VBP1 / 7411 HGNCID:12662 Length:233 Species:Homo sapiens


Alignment Length:197 Identity:100/197 - (50%)
Similarity:141/197 - (71%) Gaps:7/197 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGIMDSVEMPKLP--ENQKTFAGIPEAVFLEEIDTFMSQPENENCEKVLQRLDEQHGKYRFMAC 63
            |..:.||....::.  ..::...|||||||:|::|:||.||.||..:.||::||||:.||:||..
Human    37 MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMEL 101

  Fly    64 NLEARRRKLKSQIPDLERSLEMVNVLRKEDE---ERETQFLLSDQVFIKTLVPPTKTVYLWLGAS 125
            ||..::|:||.|||:::::||::..::|:.|   ..||:|||:|.::.|..||||..|.|||||:
Human   102 NLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGAN 166

  Fly   126 VMLEYPLDEAEALLNQNITSAVGNLKSVEHDQDFLRDQITTTEVNMARVYNWGVKKRQA--ATKT 188
            |||||.:|||:|||.:|:::|..||.|:|.|.||||||.|||||||||||||.||:|..  :||.
Human   167 VMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDSTKN 231

  Fly   189 TA 190
            .|
Human   232 KA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgrNP_650067.1 Prefoldin 58..175 CDD:281054 65/119 (55%)
VBP1NP_001290472.1 Prefoldin 96..216 CDD:397237 65/119 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160164
Domainoid 1 1.000 144 1.000 Domainoid score I4631
eggNOG 1 0.900 - - E1_KOG3313
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2531
Inparanoid 1 1.050 198 1.000 Inparanoid score I3808
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53938
OrthoDB 1 1.010 - - D1567796at2759
OrthoFinder 1 1.000 - - FOG0005083
OrthoInspector 1 1.000 - - oto88303
orthoMCL 1 0.900 - - OOG6_102595
Panther 1 1.100 - - LDO PTHR12409
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R906
SonicParanoid 1 1.000 - - X3603
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.