DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mgr and vbp1

DIOPT Version :9

Sequence 1:NP_650067.1 Gene:mgr / 41365 FlyBaseID:FBgn0264694 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001018460.1 Gene:vbp1 / 553651 ZFINID:ZDB-GENE-050522-494 Length:195 Species:Danio rerio


Alignment Length:170 Identity:92/170 - (54%)
Similarity:127/170 - (74%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NQKTFAGIPEAVFLEEIDTFMSQPENENCEKVLQRLDEQHGKYRFMACNLEARRRKLKSQIPDLE 80
            |:|...|||||:|:|::|.||.||.|:..:.||::||||:.||::|..||..::.:||||||.::
Zfish    14 NKKKHLGIPEAIFVEDVDAFMKQPGNDTADAVLRKLDEQYQKYKYMELNLGQKKLRLKSQIPQIK 78

  Fly    81 RSLEMVNVLRKE---DEERETQFLLSDQVFIKTLVPPTKTVYLWLGASVMLEYPLDEAEALLNQN 142
            ::||::..::|:   .:..||.|||:|.|:.|..||||..|.|||||:|||||.:|.|:|||.:|
Zfish    79 QTLEILRHMQKKKDTTDPMETHFLLADNVYCKASVPPTDKVCLWLGANVMLEYDIDAAQALLEKN 143

  Fly   143 ITSAVGNLKSVEHDQDFLRDQITTTEVNMARVYNWGVKKR 182
            :.:|..||.|:|.|.||||||.|||||||||||||.||:|
Zfish   144 LATASRNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgrNP_650067.1 Prefoldin 58..175 CDD:281054 63/119 (53%)
vbp1NP_001018460.1 Prefoldin 56..176 CDD:281054 63/119 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596504
Domainoid 1 1.000 136 1.000 Domainoid score I4900
eggNOG 1 0.900 - - E1_KOG3313
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2531
Inparanoid 1 1.050 190 1.000 Inparanoid score I3865
OMA 1 1.010 - - QHG53938
OrthoDB 1 1.010 - - D1567796at2759
OrthoFinder 1 1.000 - - FOG0005083
OrthoInspector 1 1.000 - - oto41723
orthoMCL 1 0.900 - - OOG6_102595
Panther 1 1.100 - - LDO PTHR12409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3603
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.