DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mgr and CG15676

DIOPT Version :9

Sequence 1:NP_650067.1 Gene:mgr / 41365 FlyBaseID:FBgn0264694 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001286689.1 Gene:CG15676 / 37472 FlyBaseID:FBgn0034651 Length:182 Species:Drosophila melanogaster


Alignment Length:184 Identity:55/184 - (29%)
Similarity:103/184 - (55%) Gaps:7/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGIMDSVEMPKLPENQKTFAGIPEAVFLEEIDTFMSQPENENCEKV---LQRLDEQHGKYRFMA 62
            |...:|:::.|.| ..:|:|..||||..::::.:::::||..:....   :|||  .:.:|..:|
  Fly     1 MFAFIDTIKKPPL-GGRKSFMPIPEAKLVDDVVSYIAKPEFYSTVPAALKMQRL--FYVQYSELA 62

  Fly    63 CNLEARRRKLKSQIPDLERSLEMV-NVLRKEDEERETQFLLSDQVFIKTLVPPTKTVYLWLGASV 126
            ..||.....:.:::...:.:||:| ..:...|:|..:...::..||....:||.:.|.|.:|||:
  Fly    63 AKLETDLTAVLTRLEAAKNNLELVRRFIDNPDKEVHSLVQIAQGVFRWVSIPPVQKVTLQVGASL 127

  Fly   127 MLEYPLDEAEALLNQNITSAVGNLKSVEHDQDFLRDQITTTEVNMARVYNWGVK 180
            .:|:.|.|||..:.::|||.|......|||.|:|:||:.|.|:|:|.:|...|:
  Fly   128 QMEFELSEAEEFIKKDITSLVKQQLQHEHDIDYLQDQVNTIEMNLAVLYKHEVE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgrNP_650067.1 Prefoldin 58..175 CDD:281054 38/117 (32%)
CG15676NP_001286689.1 Prefoldin_alpha 45..177 CDD:238327 41/133 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472754
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3313
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.