DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mgr and pac10

DIOPT Version :9

Sequence 1:NP_650067.1 Gene:mgr / 41365 FlyBaseID:FBgn0264694 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_593000.1 Gene:pac10 / 2543378 PomBaseID:SPAC3H8.07c Length:169 Species:Schizosaccharomyces pombe


Alignment Length:163 Identity:66/163 - (40%)
Similarity:95/163 - (58%) Gaps:6/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GIPEAVFLEEIDTFMSQPENENCEKVLQRLDEQHGKYRFMACNLEARRRKLKSQIPDLERSLEMV 86
            |||.|.|.|..:..|.:.:..     |::..|...||:||..::..|...|..:|||:.::|:.|
pombe     8 GIPPAQFFEFKELSMEEAQGH-----LEKFQEAIAKYKFMETSVVRRVASLDDKIPDIRKTLQSV 67

  Fly    87 NVLRKEDEERET-QFLLSDQVFIKTLVPPTKTVYLWLGASVMLEYPLDEAEALLNQNITSAVGNL 150
            ..|::...:..| .:.|:|.:..|..|.....|||||||:|||||.::||||||.|.:.||...|
pombe    68 QFLKERQGDSFTVTYELNDTLNAKAEVEAKDNVYLWLGANVMLEYTVEEAEALLTQKLNSAEETL 132

  Fly   151 KSVEHDQDFLRDQITTTEVNMARVYNWGVKKRQ 183
            |:.:.|.:|||.|:||.|||.|||||:.|..|:
pombe   133 KACKEDLEFLRAQVTTMEVNTARVYNYTVLLRK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgrNP_650067.1 Prefoldin 58..175 CDD:281054 51/117 (44%)
pac10NP_593000.1 Prefoldin 39..157 CDD:281054 51/117 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I1827
eggNOG 1 0.900 - - E1_KOG3313
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2531
Inparanoid 1 1.050 113 1.000 Inparanoid score I1555
OMA 1 1.010 - - QHG53938
OrthoFinder 1 1.000 - - FOG0005083
OrthoInspector 1 1.000 - - oto100405
orthoMCL 1 0.900 - - OOG6_102595
Panther 1 1.100 - - LDO PTHR12409
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R906
SonicParanoid 1 1.000 - - X3603
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.