DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mgr and Vbp1

DIOPT Version :9

Sequence 1:NP_650067.1 Gene:mgr / 41365 FlyBaseID:FBgn0264694 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_035822.2 Gene:Vbp1 / 22327 MGIID:1333804 Length:196 Species:Mus musculus


Alignment Length:174 Identity:97/174 - (55%)
Similarity:133/174 - (76%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GIPEAVFLEEIDTFMSQPENENCEKVLQRLDEQHGKYRFMACNLEARRRKLKSQIPDLERSLEMV 86
            |||||||:|::|:||.||.||..:.||::||||:.||:||..||..::|:||.|||:::::||::
Mouse    23 GIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEIL 87

  Fly    87 NVLRKEDE---ERETQFLLSDQVFIKTLVPPTKTVYLWLGASVMLEYPLDEAEALLNQNITSAVG 148
            ..::|:.|   ..||:|||:|.::.|..||||..|.|||||:|||||.:|||:|||.:|:::|..
Mouse    88 KYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTATK 152

  Fly   149 NLKSVEHDQDFLRDQITTTEVNMARVYNWGVKKRQA--ATKTTA 190
            ||.|:|.|.||||||.|||||||||||||.||:|..  :||..|
Mouse   153 NLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDSTKNKA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgrNP_650067.1 Prefoldin 58..175 CDD:281054 65/119 (55%)
Vbp1NP_035822.2 Prefoldin_alpha 49..180 CDD:238327 72/130 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850538
Domainoid 1 1.000 144 1.000 Domainoid score I4606
eggNOG 1 0.900 - - E1_KOG3313
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2531
Inparanoid 1 1.050 198 1.000 Inparanoid score I3793
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53938
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005083
OrthoInspector 1 1.000 - - oto91875
orthoMCL 1 0.900 - - OOG6_102595
Panther 1 1.100 - - LDO PTHR12409
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R906
SonicParanoid 1 1.000 - - X3603
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.