DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mgr and vbp1

DIOPT Version :9

Sequence 1:NP_650067.1 Gene:mgr / 41365 FlyBaseID:FBgn0264694 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001120592.1 Gene:vbp1 / 100145749 XenbaseID:XB-GENE-980556 Length:192 Species:Xenopus tropicalis


Alignment Length:169 Identity:94/169 - (55%)
Similarity:131/169 - (77%) Gaps:3/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QKTFAGIPEAVFLEEIDTFMSQPENENCEKVLQRLDEQHGKYRFMACNLEARRRKLKSQIPDLER 81
            ::|..|||||||:|::|.||.:|.||..:.||::||||:.||:||..||..::|:||||||::::
 Frog    14 KRTHLGIPEAVFVEDVDAFMKKPGNETADAVLKKLDEQYQKYKFMELNLTQKKRRLKSQIPEIKQ 78

  Fly    82 SLEMVNVLRKEDEERE---TQFLLSDQVFIKTLVPPTKTVYLWLGASVMLEYPLDEAEALLNQNI 143
            :||::..::|:.:..|   |:|||:|.::.|..||||..|.|||||:|||||.:|||:|||.:|:
 Frog    79 TLEILKHMQKKKDTTEPMKTRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNL 143

  Fly   144 TSAVGNLKSVEHDQDFLRDQITTTEVNMARVYNWGVKKR 182
            ::|..||.|.|.|.||||||.|||||||||||||.||:|
 Frog   144 STATRNLDSTEEDLDFLRDQFTTTEVNMARVYNWDVKRR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgrNP_650067.1 Prefoldin 58..175 CDD:281054 65/119 (55%)
vbp1NP_001120592.1 Prefoldin 55..174 CDD:367288 64/118 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2531
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53938
OrthoDB 1 1.010 - - D1567796at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12409
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R906
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.