DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KP78a and SR1

DIOPT Version :10

Sequence 1:NP_650066.1 Gene:KP78a / 41362 FlyBaseID:FBgn0026064 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_195802.1 Gene:SR1 / 831765 AraportID:AT5G01820 Length:442 Species:Arabidopsis thaliana


Alignment Length:56 Identity:15/56 - (26%)
Similarity:23/56 - (41%) Gaps:11/56 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 IAENAAGKSLTSAEY----------LFNTTQSGMLSSVRVFIGSLEPHLTFKNIAL 806
            |.|.||.:.|..|.:          ||:..| |.::.|...:....|...|.|:|:
plant    69 ITEMAAAQGLMDARFSFPALPFATHLFHPKQ-GAIAHVIPALHKDRPRFDFANLAI 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KP78aNP_650066.1 Protein Kinases, catalytic domain 98..349 CDD:473864
UBA_MARK_Par1 370..408 CDD:270522
SR1NP_195802.1 Protein Kinases, catalytic domain 21..275 CDD:473864 15/56 (27%)
CIPK_C 311..419 CDD:213380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.