DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KP78a and Smok3c

DIOPT Version :9

Sequence 1:NP_650066.1 Gene:KP78a / 41362 FlyBaseID:FBgn0026064 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001297632.1 Gene:Smok3c / 622486 MGIID:3647925 Length:504 Species:Mus musculus


Alignment Length:460 Identity:142/460 - (30%)
Similarity:235/460 - (51%) Gaps:56/460 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 YKIIKTLGKGNFAKVKLAIHVPTGREVAIKVIDKTQLNTSARQK-------LYREVKIMKLLNHP 155
            |.:::|:|.|..|.||||.|..||..||:|.|          ||       :..||.::.:.:||
Mouse    28 YVMLETIGHGGCATVKLAQHRLTGTHVAVKTI----------QKRGYWCILIMSEVDLLMMADHP 82

  Fly   156 NIVRLFQVIESERTLYLVMEYASRGELFDHLVKNGRMRERDARVIFRQLVSAIQYCHSKFVVHRD 220
            |::.|.||||:::.:||:||......|:.|:.|.|.::|.:||.:|:||:||:.|||::.:||||
Mouse    83 NVISLLQVIETKKKVYLIMELCEGKSLYQHIRKAGYLQEHEARALFKQLLSAMNYCHNQGIVHRD 147

  Fly   221 LKAENLLLDQHMNIKIADFGFGNTFDPNAQLETFCGSPPYAAPELFMGRKYAGPEVDAWSLGVVL 285
            ||.:|:::::...:||.|||......|..:|..|||:.|::|||:.:...|.||::|.|:|||||
Mouse   148 LKPDNIMVEKDGKVKIIDFGLSTKVKPGQKLNLFCGTYPFSAPEVLLSTPYDGPKIDVWTLGVVL 212

  Fly   286 YTLVSGSLPFDGGTLKELRERVLRGKYRVPYYISMDCENLMRKFLVLNPAKRTSLSAVMSDKWIN 350
            |.:|:|.:|||..::|.|.:|:|.|||.:|..:|.:..:|:...:..||..|.:::.||...|:.
Mouse   213 YFMVTGKIPFDACSIKRLVKRILAGKYSIPSRLSAELRDLLSLLMTANPKLRPTVAEVMVHPWVT 277

  Fly   351 LGH----DESDRLRPFREKPMELQDAARFDLLMSMGH---KRRDVEQSVKGQLFDDIYCTYMLLG 408
            .|.    |..:...|.:..|.         ::.:|||   :.:|:|.|::.:.|:....:|.||.
Mouse   278 EGSGVFPDPCEEQTPLKPDPA---------IVKAMGHIGFQAQDIEDSLRQRKFNQTMASYCLLK 333

  Fly   409 VAKPRSSNRSTKPEAIPTVDLTTPAVSSPLPNITTPTVTIAHVTLALDKNPPIHSSSASGRPIA- 472
            ....:..:|.|:...:      .|:| :|.|::.....|.  :.|...:|.|....|::.|.:: 
Mouse   334 KQILKECDRPTRARPV------NPSV-TPFPSLVDTATTC--LGLRRRENEPTCPWSSANRQVSV 389

  Fly   473 ---------PRLANAPNTPTSTPPTGPPAKPTRRTPARTPARKATNHTSGQGRPEPSSLPHTPQS 528
                     .|..:.|:.......|.|....||......|...:...|......|.|:..||   
Mouse   390 CGKSTSKKRDRRVSWPSVLGRPRHTAPTMDHTRTRTRSVPCICSMFCTVQPNSSEESTQGHT--- 451

  Fly   529 KRASA 533
             ||||
Mouse   452 -RASA 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KP78aNP_650066.1 PKc_like 98..349 CDD:304357 99/257 (39%)
S_TKc 98..349 CDD:214567 99/257 (39%)
Smok3cNP_001297632.1 STKc_AMPK-like 27..275 CDD:270905 99/256 (39%)
UBA_MARK_Par1 295..334 CDD:270522 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.