DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KP78a and Pask

DIOPT Version :9

Sequence 1:NP_650066.1 Gene:KP78a / 41362 FlyBaseID:FBgn0026064 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_611864.1 Gene:Pask / 37824 FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster


Alignment Length:310 Identity:90/310 - (29%)
Similarity:155/310 - (50%) Gaps:20/310 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TSNATALPATPTVAAGQDLGDGAC---SSKNTDSKFQSYVN----GNGNGVYKIIKTLGKGNFAK 111
            ||...::.:|...:.||.:...|.   |..|:.|....|.:    |:.:..|..|:.:|:|.:..
  Fly   525 TSTFNSMASTVEQSLGQVIKTTAAQNSSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGY 589

  Fly   112 VKLAIHVPTGREVAIKVIDK----TQLNTSAR--QKLYREVKIMKLLNHPNIVRLFQVIESERTL 170
            |.:|........|..|.|.|    :|....:|  :::..|:.:::.|||.|||.:..|.|::...
  Fly   590 VNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTLNHKNIVSVLDVFENDLFY 654

  Fly   171 YLVME-YASRGELFDHLVKNGRMRERDARVIFRQLVSAIQYCHSKFVVHRDLKAENLLLDQHMNI 234
            .|||| :.|..:|:..:.:...|.|:....||||:..|:.|.|.:.::|||:|.||:::||:..|
  Fly   655 QLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDENIIIDQNFTI 719

  Fly   235 KIADFGFGNTFDPNAQLETFCGSPPYAAPELFMGRKYAGPEVDAWSLGVVLYTLVSGSLPFDGGT 299
            |:.|||.....:......||.|:..|.:||:..|.:|.|||::.|:|||.||.|:....||..  
  Fly   720 KLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMFFENPFID-- 782

  Fly   300 LKELRERVLRGKYRVPYYISMDCENLMRKFLVLNPAKRTSLSAVMSDKWI 349
                .|..|:.:.::|..:|.....|:...|..:|..|.::..:::|.|:
  Fly   783 ----VEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDPWL 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KP78aNP_650066.1 PKc_like 98..349 CDD:304357 78/257 (30%)
S_TKc 98..349 CDD:214567 78/257 (30%)
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 78/258 (30%)
S_TKc 576..828 CDD:214567 78/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.