DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KP78a and Gm4567

DIOPT Version :9

Sequence 1:NP_650066.1 Gene:KP78a / 41362 FlyBaseID:FBgn0026064 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001032325.1 Gene:Gm4567 / 100043645 MGIID:3809658 Length:301 Species:Mus musculus


Alignment Length:277 Identity:120/277 - (43%)
Similarity:175/277 - (63%) Gaps:19/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QDLGDGACSS--KNTDSKFQSYVNGNGNGVYKIIKTLGKGNFAKVKLAIHVPTGREVAIKVIDKT 132
            |||  .||.|  :|.|:.            ||::.|||:|.|:.||.|.||||...||:|::..|
Mouse    11 QDL--KACYSIEENFDTN------------YKMLNTLGEGKFSVVKRAFHVPTSTSVAVKILQNT 61

  Fly   133 QLNTSARQKLYREVKIMKLLNHPNIVRLFQVIESERTLYLVMEYASRGELFDHLVKNGRMRERDA 197
            :..||   .:.||.:|||.|:||||::||.|::...|.||||||||.|||.|.::|.|.:.|.:.
Mouse    62 KEYTS---PICREARIMKSLSHPNIIKLFHVVQRRETTYLVMEYASEGELQDRIIKVGSLEESET 123

  Fly   198 RVIFRQLVSAIQYCHSKFVVHRDLKAENLLLDQHMNIKIADFGFGNTFDPNAQLETFCGSPPYAA 262
            |.:|.|:|.|:||||...:||||:||.|:|:|...|.|:.|||......|..:|..|||:.||.|
Mouse   124 RRLFAQIVHAVQYCHDHHIVHRDIKASNILIDYRGNAKLCDFGLAAEVIPGQKLAGFCGTLPYCA 188

  Fly   263 PELFMGRKYAGPEVDAWSLGVVLYTLVSGSLPFDGGTLKELRERVLRGKYRVPYYISMDCENLMR 327
            |||....||.||.||.|||||:|:.:|||:|||.|....:|::.::...:.:|.::|:|..|::.
Mouse   189 PELLQAEKYEGPPVDIWSLGVLLFLMVSGNLPFQGRYFVDLKQEIISANFSIPSHVSIDILNVII 253

  Fly   328 KFLVLNPAKRTSLSAVM 344
            :.|::||::|.::..:|
Mouse   254 ELLMINPSRRPTIHQIM 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KP78aNP_650066.1 PKc_like 98..349 CDD:304357 112/247 (45%)
S_TKc 98..349 CDD:214567 112/247 (45%)
Gm4567NP_001032325.1 STKc_AMPK-like 26..273 CDD:270905 112/260 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.