DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KP78b and PRKCI

DIOPT Version :9

Sequence 1:NP_001163587.1 Gene:KP78b / 41361 FlyBaseID:FBgn0026063 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_002731.4 Gene:PRKCI / 5584 HGNCID:9404 Length:596 Species:Homo sapiens


Alignment Length:274 Identity:84/274 - (30%)
Similarity:150/274 - (54%) Gaps:26/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RSSPKFQSYVNGNGYGVYKIIKTLGKGNFAKVKLAIHLPTGREVAIKLIDKTALNT------IAR 104
            |.|.|..|.:   |...:.:::.:|:|::|||.|.....|.|..|:|::.|..:|.      :..
Human   240 RESGKASSSL---GLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQT 301

  Fly   105 QK-LYREVNIMKKLNHPNIVRLLQVIESERTLYLVMEYVSGGELFNYLVKNGRMRERDARVLFRQ 168
            :| ::.:.:     |||.:|.|....::|..|:.|:|||:||:|..::.:..::.|..||....:
Human   302 EKHVFEQAS-----NHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAE 361

  Fly   169 LVSAIEYCHSKSIVHRDLKAENLLLDQQMKLKIADFGF-STTFEPKAPLETFCGSPPYAAPELFR 232
            :..|:.|.|.:.|::||||.:|:|||.:..:|:.|:|. .....|.....||||:|.|.|||:.|
Human   362 ISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILR 426

  Fly   233 GKKYSGPEVDSWSLGVVLYTLVSGSLPFDGTNLKELRDR---------VLRGKYRVPYYVSIECE 288
            |:.| |..||.|:|||:::.:::|..|||.....:..|:         :|..:.|:|..:|::..
Human   427 GEDY-GFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAA 490

  Fly   289 SLIRKFLVLNPTQR 302
            |:::.||..:|.:|
Human   491 SVLKSFLNKDPKER 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KP78bNP_001163587.1 PKc_like 63..314 CDD:304357 79/257 (31%)
S_TKc 63..314 CDD:214567 79/257 (31%)
PRKCINP_002731.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Regulatory domain 2..253 5/15 (33%)
Required for interaction with RAB2 2..28
PB1_aPKC 26..108 CDD:99725
Interaction with PARD6A 72..91
Pseudosubstrate. /evidence=ECO:0000250 125..134
C1_1 141..191 CDD:365894
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..246 3/5 (60%)
STKc_aPKC_iota 233..596 CDD:270769 84/274 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.