DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KP78b and 1810024B03Rik

DIOPT Version :9

Sequence 1:NP_001163587.1 Gene:KP78b / 41361 FlyBaseID:FBgn0026063 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_941032.1 Gene:1810024B03Rik / 329509 MGIID:1925560 Length:200 Species:Mus musculus


Alignment Length:138 Identity:61/138 - (44%)
Similarity:85/138 - (61%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 MKKLNHPNIVRLLQVIESERTLYLVMEYVSGGELFNYLVKNGRMRERDARVLFRQLVSAIEYCHS 178
            ||.|:|.:|::||||.::....||||||.|.|.|..|:.|...:.|.:|..:|.:|..|:.|.||
Mouse     1 MKSLHHRHILQLLQVFQTRHKTYLVMEYASRGSLLKYIKKRRPLDEEEACTMFSELSLAVNYIHS 65

  Fly   179 KSIVHRDLKAENLLLDQQMKLKIADFGFSTTFEPKAPLETFCGSPPYAAPELFRGKKYSGPEVDS 243
            ::|.|:|:||||:|||....:|:.|||.|.........:.|||:..|.|||:|...:|.|...|.
Mouse    66 QNIAHQDIKAENILLDWDGHVKLTDFGISKRLASGEKFKGFCGTAQYCAPEVFNDTQYGGLPSDI 130

  Fly   244 WSLGVVLY 251
            ||||:|||
Mouse   131 WSLGMVLY 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KP78bNP_001163587.1 PKc_like 63..314 CDD:304357 61/138 (44%)
S_TKc 63..314 CDD:214567 61/138 (44%)
1810024B03RikNP_941032.1 PKc_like <1..172 CDD:389743 61/138 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.