DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KP78b and Y60A3A.16

DIOPT Version :9

Sequence 1:NP_001163587.1 Gene:KP78b / 41361 FlyBaseID:FBgn0026063 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001370082.1 Gene:Y60A3A.16 / 190438 WormBaseID:WBGene00013364 Length:142 Species:Caenorhabditis elegans


Alignment Length:79 Identity:18/79 - (22%)
Similarity:27/79 - (34%) Gaps:25/79 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 KTTLLSAQRKLAVNQK---------------LTSASHQIRSPITQSPS--QASECTRTP-----P 535
            ||::|.....|...||               |...||.  .|:|.:..  :...|| .|     .
 Worm    55 KTSMLEPDEILKEIQKVLGSYGIDYEQQKRFLLRCSHV--DPLTDASVKWEIEVCT-LPRLYLNG 116

  Fly   536 THFEMLDSTSTPLK 549
            .||:.:..:|:..|
 Worm   117 VHFQRISGSSSDFK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KP78bNP_001163587.1 PKc_like 63..314 CDD:304357
S_TKc 63..314 CDD:214567
Y60A3A.16NP_001370082.1 AMPKA_C_like 44..140 CDD:418410 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161941
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.