DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KP78b and Gm10662

DIOPT Version :9

Sequence 1:NP_001163587.1 Gene:KP78b / 41361 FlyBaseID:FBgn0026063 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001188293.1 Gene:Gm10662 / 100043665 MGIID:3642760 Length:313 Species:Mus musculus


Alignment Length:247 Identity:106/247 - (42%)
Similarity:160/247 - (64%) Gaps:3/247 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YKIIKTLGKGNFAKVKLAIHLPTGREVAIKLIDKTALNTIARQKLYREVNIMKKLNHPNIVRLLQ 127
            ||::.|||:|||:.||.|.|:||...||:|::..|...|   ..:.||..|||.|:||||::|..
Mouse    34 YKMLNTLGEGNFSVVKRAFHVPTSTSVAVKILQNTKEYT---SPICREARIMKSLSHPNIIKLFH 95

  Fly   128 VIESERTLYLVMEYVSGGELFNYLVKNGRMRERDARVLFRQLVSAIEYCHSKSIVHRDLKAENLL 192
            |::...|.||||||.|.|||.:.::....:.|.:.|.||.|:|.|::|||...|||||:||.|:|
Mouse    96 VVQRRETTYLVMEYASEGELLDRIINVVSLEESETRRLFAQIVHAVQYCHDHHIVHRDIKASNIL 160

  Fly   193 LDQQMKLKIADFGFSTTFEPKAPLETFCGSPPYAAPELFRGKKYSGPEVDSWSLGVVLYTLVSGS 257
            :|.:...|:.|||.:....|...|..|||:.||.||||.:.:||.|..||.|||||:|:.:|||:
Mouse   161 IDCRGNAKLCDFGLAAEVIPGQKLAGFCGTLPYCAPELLQAEKYEGLPVDIWSLGVLLFLMVSGN 225

  Fly   258 LPFDGTNLKELRDRVLRGKYRVPYYVSIECESLIRKFLVLNPTQRTSLSAVM 309
            |||.|.:..:|:..::...:.:|.:|||:..::|.:.|::||::|.::..:|
Mouse   226 LPFQGRSFVDLKQEIISANFSIPSHVSIDISNVIIELLMINPSRRPTIHQIM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KP78bNP_001163587.1 PKc_like 63..314 CDD:304357 106/247 (43%)
S_TKc 63..314 CDD:214567 106/247 (43%)
Gm10662NP_001188293.1 STKc_AMPK-like 33..280 CDD:270905 106/247 (43%)
S_TKc 34..282 CDD:214567 106/247 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.