DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5214 and PDX1

DIOPT Version :9

Sequence 1:NP_650064.1 Gene:CG5214 / 41360 FlyBaseID:FBgn0037891 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_011709.1 Gene:PDX1 / 853107 SGDID:S000003425 Length:410 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:30/92 - (32%)
Similarity:51/92 - (55%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QEATRLLTWQGIHTTSSLWSEQTVNVPPFADSIAEGDI-KFTCKVGDSFAADEAVMEIETDKTTV 119
            :..||.||....|.::.|.:.:|.::|..:.::.:|.| .:..|||:.|:|.:.::|:||||:.:
Yeast    12 KSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVETDKSQI 76

  Fly   120 AVPAPFSGTLTDIL----VKDGDTVKP 142
            .|.|...|.|..||    .||.|..:|
Yeast    77 DVEALDDGKLAKILKDEGSKDVDVGEP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5214NP_650064.1 lipoyl_domain 77..149 CDD:133458 24/71 (34%)
sucB 78..468 CDD:273565 24/70 (34%)
2-oxoacid_dh 255..462 CDD:278621
PDX1NP_011709.1 AceF 31..410 CDD:223582 24/73 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.