powered by:
Protein Alignment CG17734 and RCF1
DIOPT Version :9
Sequence 1: | NP_001247043.1 |
Gene: | CG17734 / 41359 |
FlyBaseID: | FBgn0037890 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013682.1 |
Gene: | RCF1 / 854978 |
SGDID: | S000004492 |
Length: | 159 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 55 |
Identity: | 13/55 - (23%) |
Similarity: | 19/55 - (34%) |
Gaps: | 8/55 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 SLFDSEE----DAAQANKLSRKAKESPFMLVGEFCQFPDSESFAAVTS--HGNFW 53
|.||..| |.....::....|:.|.:.:| |.........|..: .||.|
Yeast 6 SSFDVTERDLDDMTFGERIIYHCKKQPLVPIG--CLLTTGAVILAAQNVRLGNKW 58
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17734 | NP_001247043.1 |
None |
RCF1 | NP_013682.1 |
HIG_1_N |
32..81 |
CDD:398334 |
7/29 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4431 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12297 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.