powered by:
Protein Alignment CG17734 and Higd2a
DIOPT Version :9
Sequence 1: | NP_001247043.1 |
Gene: | CG17734 / 41359 |
FlyBaseID: | FBgn0037890 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_080209.1 |
Gene: | Higd2a / 67044 |
MGIID: | 1914294 |
Length: | 106 |
Species: | Mus musculus |
Alignment Length: | 30 |
Identity: | 8/30 - (26%) |
Similarity: | 17/30 - (56%) |
Gaps: | 2/30 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SKSLFDSEEDAAQANKLSRKAKESPFMLVG 32
|.:::.:.|...: |..||.:|:|.:.:|
Mouse 25 SPTVYSNPEGFKE--KFIRKTRENPMVPIG 52
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17734 | NP_001247043.1 |
None |
Higd2a | NP_080209.1 |
HIG_1_N |
47..96 |
CDD:398334 |
2/6 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4431 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.