powered by:
Protein Alignment CG17734 and CG9921
DIOPT Version :9
Sequence 1: | NP_001247043.1 |
Gene: | CG17734 / 41359 |
FlyBaseID: | FBgn0037890 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001259608.1 |
Gene: | CG9921 / 32599 |
FlyBaseID: | FBgn0030743 |
Length: | 102 |
Species: | Drosophila melanogaster |
Alignment Length: | 49 |
Identity: | 16/49 - (32%) |
Similarity: | 21/49 - (42%) |
Gaps: | 17/49 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSSK---SLFDSEEDAAQ--------------ANKLSRKAKESPFMLVG 32
||:| ||.:.|.|..| ..||.||.||:|.:.:|
Fly 1 MSNKIEVSLPEEELDWIQLRQDLGPVAEVETTKEKLQRKIKENPLVPLG 49
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17734 | NP_001247043.1 |
None |
CG9921 | NP_001259608.1 |
HIG_1_N |
44..91 |
CDD:282450 |
2/6 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4431 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12297 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.