DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17734 and METTL7A

DIOPT Version :9

Sequence 1:NP_001247043.1 Gene:CG17734 / 41359 FlyBaseID:FBgn0037890 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_054752.3 Gene:METTL7A / 25840 HGNCID:24550 Length:244 Species:Homo sapiens


Alignment Length:149 Identity:29/149 - (19%)
Similarity:48/149 - (32%) Gaps:56/149 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSK--SLFDS-EEDAAQANKLSRKAKESPFMLVG-----EFCQFPDSESFAAVTSHGNF--WLS 55
            |:||  .||.: :|.|..:.|||       .:.||     .|..:|.......:..:.||  :|.
Human    51 MASKKRELFSNLQEFAGPSGKLS-------LLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLI 108

  Fly    56 SQL--DTHI-------------------STHIYECTL---RVRRGSRLILTLAMSL--------- 87
            ..:  :.|:                   |..:..|||   .|:...|::..:...|         
Human   109 KSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFM 173

  Fly    88 ------TSIWGHFLMSLCD 100
                  .|.|.:|...:.|
Human   174 EHVAAECSTWNYFWQQVLD 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17734NP_001247043.1 None
METTL7ANP_054752.3 Targeting to lipid droplets 1..28
Methyltransf_11 75..172 CDD:311935 15/96 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5299
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.