powered by:
Protein Alignment CG17734 and SPAC25B8.07c
DIOPT Version :9
Sequence 1: | NP_001247043.1 |
Gene: | CG17734 / 41359 |
FlyBaseID: | FBgn0037890 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_594467.1 |
Gene: | SPAC25B8.07c / 2542662 |
PomBaseID: | SPAC25B8.07c |
Length: | 113 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 52 |
Identity: | 18/52 - (34%) |
Similarity: | 20/52 - (38%) |
Gaps: | 18/52 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSSKSLFDSEED------AAQANKLSRKAK------ESPF------MLVGEF 34
||||....|||: .|....|||..| .:|| |.||.|
pombe 1 MSSKLPKKSEENLELPTFPASEESLSRSEKLKYVFVRNPFIPLGCLMTVGTF 52
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17734 | NP_001247043.1 |
None |
SPAC25B8.07c | NP_594467.1 |
HIG_1_N |
39..86 |
CDD:282450 |
6/14 (43%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4431 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12297 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.