DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and PRY1

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:135 Identity:29/135 - (21%)
Similarity:45/135 - (33%) Gaps:47/135 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 MSWCEELSHLALLNVKTCESLPDK--CRSTERFAYA--GQNNALFQYSGAETEYTDAEIIKEEIE 150
            :||.:.|:..|       :...|.  |..|...:..  |:|.|| .|.|...           ::
Yeast   183 LSWSDTLASYA-------QDYADNYDCSGTLTHSGGPYGENLAL-GYDGPAA-----------VD 228

  Fly   151 NWFAERSN---ASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNFA 212
            .|:.|.||   ::|...::         ...||..|.:..|.|||.            :.||..|
Yeast   229 AWYNEISNYDFSNPGFSSN---------TGHFTQVVWKSTTQVGCG------------IKTCGGA 272

  Fly   213 TSNIV 217
            ..:.|
Yeast   273 WGDYV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 27/128 (21%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 29/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344529
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.