DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and AT1G50060

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_175428.1 Gene:AT1G50060 / 841430 AraportID:AT1G50060 Length:161 Species:Arabidopsis thaliana


Alignment Length:214 Identity:49/214 - (22%)
Similarity:77/214 - (35%) Gaps:64/214 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAVVAISSAVDYCALPTCLDKHVACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAGG 76
            |.:||||..|            ||.|     ::|.|:|            .||..|..|..|   
plant     9 LVIVAISFLV------------VATN-----AQNTPQD------------YLNSHNTARAQV--- 41

  Fly    77 KIEGLPKAVRMAKMSWCEELSHLAL--LNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEY 139
               |:|..|      |...|:..||  .|.:..:     |.........|:|.|    .|:.:.:
plant    42 ---GVPNVV------WDTTLAAYALNYSNFRKAD-----CNLVHSNGPYGENLA----KGSSSSF 88

  Fly   140 TDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNH 204
            :....:|    .|..|:    |....::......|....:|..|...:..:|||.|:.:..::  
plant    89 SAISAVK----LWVDEK----PYYSYAYNNCTGGKQCLHYTQVVWRDSVKIGCARVQCTNTWW-- 143

  Fly   205 FVLTCNF-ATSNIVGQPVY 222
            || :||: :..|.||:..|
plant   144 FV-SCNYNSPGNWVGEYPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 33/154 (21%)
AT1G50060NP_175428.1 CAP_PR-1 27..161 CDD:349400 38/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.