DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Crispld1

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:226 Identity:54/226 - (23%)
Similarity:81/226 - (35%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC----RSTERFAY 122
            ||:|.|:||:.|       .|.|..|..|:|..||.       ::.||..:.|    ........
Mouse    65 ILDLHNKLRSQV-------YPTASNMEYMTWDVELE-------RSAESWAEMCLWEHGPASLLPS 115

  Fly   123 AGQNNALFQYSGAETEYTDAEIIKEEIENWFAE-RSNASP---EILASFPEELPNKAVTKFTIAV 183
            .|||  |..:.|.....|      ..::.|:.| |..:.|   |.....|........|.:|..|
Mouse   116 IGQN--LGAHWGRYRPPT------FHVQAWYDEVRDFSYPYENECDPYCPFRCSGPVCTHYTQVV 172

  Fly   184 AEKNTHVGCAA-VRFSRDFYNHF-----VLTCNFA-TSNIVGQPVYTPGEKATTGCKNRYGAAYD 241
            ...::.:|||. :..:.:.:...     .|.||:: ..|..|...|..| :..:.|...:|... 
Mouse   173 WATSSRIGCAVNLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHG-RPCSACPPSFGGGC- 235

  Fly   242 YPNLCY---------AKEIYDNEKVIENTQT 263
            ..||||         .:|...||  ||..|:
Mouse   236 RENLCYKEGSDRYYTPREEETNE--IERQQS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 38/163 (23%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 38/163 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281 4/9 (44%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841225
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.