DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and CRISPLD1

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:226 Identity:53/226 - (23%)
Similarity:80/226 - (35%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC----RSTERFAY 122
            ||:|.|:||:.|       .|.|..|..|:|..||.       ::.||..:.|    ........
Human    65 ILDLHNKLRSQV-------YPTASNMEYMTWDVELE-------RSAESWAESCLWEHGPASLLPS 115

  Fly   123 AGQNNALFQYSGAETEYTDAEIIKEEIENWFAERSNAS----PEILASFPEELPNKAVTKFTIAV 183
            .|||  |..:.|.....|      ..:::|:.|..:.|    .|.....|........|.:|..|
Human   116 IGQN--LGAHWGRYRPPT------FHVQSWYDEVKDFSYPYEHECNPYCPFRCSGPVCTHYTQVV 172

  Fly   184 AEKNTHVGCAA-VRFSRDFYNHF-----VLTCNFA-TSNIVGQPVYTPGEKATTGCKNRYGAAYD 241
            ...:..:|||. :..:.:.:...     .|.||:: ..|..|...|..| :..:.|...:|... 
Human   173 WATSNRIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHG-RPCSACPPSFGGGC- 235

  Fly   242 YPNLCY---------AKEIYDNEKVIENTQT 263
            ..||||         .:|...||  ||..|:
Human   236 RENLCYKEGSDRYYPPREEETNE--IERQQS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 37/163 (23%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 37/163 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281 5/13 (38%)
LCCL 291..375 CDD:128866
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151148
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.