DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and AT3G09590

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:132 Identity:27/132 - (20%)
Similarity:49/132 - (37%) Gaps:22/132 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEI 144
            |:|      .:.|..:|:..|   .|..:.....|.........|:|  :|.:...:| ::..::
plant    65 GVP------TLGWDRDLARFA---DKWAKQRKSDCSMIHSGGPYGEN--IFWHRRKKT-WSPEKV 117

  Fly   145 IKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTC 209
                :..||.||.|...:....    .|.|....:|..|..:.|.||||.|:....  ..:::.|
plant   118 ----VTRWFEERFNYDVKTNTC----APGKMCGHYTQMVWRETTAVGCARVKCHNG--RGYLVVC 172

  Fly   210 NF 211
            .:
plant   173 EY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 27/132 (20%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.